Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii

Patsy S. Dickinson; Elizabeth A. Stemmler; Elizabeth E. Barton; Christopher R. Cashman; Noah P. Gardner; Szymon Rus; Henry R. Brennan; Timothy S. McClintock; Andrew E. Christie

doi:10.1016/j.peptides.2008.10.009

Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii

Patsy S. Dickinson, Elizabeth A. Stemmler, Elizabeth E. Barton, Christopher R. Cashman, Noah P. Gardner, Szymon Rus, Henry R. Brennan, Timothy S. McClintock, Andrew E. Christie

Physiology

Research output: Contribution to journal › Article › peer-review

45 Scopus citations

Abstract

Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY_(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans.

Original language	English
Pages (from-to)	297-317
Number of pages	21
Journal	Peptides
Volume	30
Issue number	2
DOIs	https://doi.org/10.1016/j.peptides.2008.10.009
State	Published - Feb 2009

Bibliographical note

Funding Information:
Financial support for this work was provided by National Science Foundation grants IBN-0111040 (PSD) and MRI-0116416 (EAS), NIH Grant Number P20 RR-016463 from the INBRE Program of the National Center for Research Resources (to MDIBL; Patricia Hand Ph.D., PI), the Arnold and Mabel Beckman Foundation (CRC), the Merck Foundation (CRC), a Mount Desert Island Biological Laboratory New Investigator Award through the Salisbury Cove Research Fund provided by the Thomas H. Maren Foundation (AEC), and through institutional funds provided by MDIBL (AEC).

Keywords

Commissural ganglion
Expressed sequence tag (EST)
Homarus americanus
Matrix assisted laser desorption/ionization Fourier transform mass spectrometry
Orcokinin
Orcomyotropin
Procambarus clarkii
Sinus gland
Stomatogastric ganglion
Supraoesophageal ganglion
cDNA

ASJC Scopus subject areas

Biochemistry
Physiology
Endocrinology
Cellular and Molecular Neuroscience

Access to Document

10.1016/j.peptides.2008.10.009

Cite this

Dickinson, P. S., Stemmler, E. A., Barton, E. E., Cashman, C. R., Gardner, N. P., Rus, S., Brennan, H. R., McClintock, T. S., & Christie, A. E. (2009). Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii. Peptides, 30(2), 297-317. https://doi.org/10.1016/j.peptides.2008.10.009

@article{8bad7a75f5a848c7baaf759104ee2d4c,

title = "Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii",

abstract = "Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans.",

keywords = "Commissural ganglion, Expressed sequence tag (EST), Homarus americanus, Matrix assisted laser desorption/ionization Fourier transform mass spectrometry, Orcokinin, Orcomyotropin, Procambarus clarkii, Sinus gland, Stomatogastric ganglion, Supraoesophageal ganglion, cDNA",

author = "Dickinson, {Patsy S.} and Stemmler, {Elizabeth A.} and Barton, {Elizabeth E.} and Cashman, {Christopher R.} and Gardner, {Noah P.} and Szymon Rus and Brennan, {Henry R.} and McClintock, {Timothy S.} and Christie, {Andrew E.}",

note = "Funding Information: Financial support for this work was provided by National Science Foundation grants IBN-0111040 (PSD) and MRI-0116416 (EAS), NIH Grant Number P20 RR-016463 from the INBRE Program of the National Center for Research Resources (to MDIBL; Patricia Hand Ph.D., PI), the Arnold and Mabel Beckman Foundation (CRC), the Merck Foundation (CRC), a Mount Desert Island Biological Laboratory New Investigator Award through the Salisbury Cove Research Fund provided by the Thomas H. Maren Foundation (AEC), and through institutional funds provided by MDIBL (AEC).",

year = "2009",

month = feb,

doi = "10.1016/j.peptides.2008.10.009",

language = "English",

volume = "30",

pages = "297--317",

number = "2",

}

Dickinson, PS, Stemmler, EA, Barton, EE, Cashman, CR, Gardner, NP, Rus, S, Brennan, HR, McClintock, TS & Christie, AE 2009, 'Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii', Peptides, vol. 30, no. 2, pp. 297-317. https://doi.org/10.1016/j.peptides.2008.10.009

Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii. / Dickinson, Patsy S.; Stemmler, Elizabeth A.; Barton, Elizabeth E. et al.
In: Peptides, Vol. 30, No. 2, 02.2009, p. 297-317.

Research output: Contribution to journal › Article › peer-review

TY - JOUR

T1 - Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii

AU - Dickinson, Patsy S.

AU - Stemmler, Elizabeth A.

AU - Barton, Elizabeth E.

AU - Cashman, Christopher R.

AU - Gardner, Noah P.

AU - Rus, Szymon

AU - Brennan, Henry R.

AU - McClintock, Timothy S.

AU - Christie, Andrew E.

N1 - Funding Information: Financial support for this work was provided by National Science Foundation grants IBN-0111040 (PSD) and MRI-0116416 (EAS), NIH Grant Number P20 RR-016463 from the INBRE Program of the National Center for Research Resources (to MDIBL; Patricia Hand Ph.D., PI), the Arnold and Mabel Beckman Foundation (CRC), the Merck Foundation (CRC), a Mount Desert Island Biological Laboratory New Investigator Award through the Salisbury Cove Research Fund provided by the Thomas H. Maren Foundation (AEC), and through institutional funds provided by MDIBL (AEC).

PY - 2009/2

Y1 - 2009/2

N2 - Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans.

AB - Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans.

KW - Commissural ganglion

KW - Expressed sequence tag (EST)

KW - Homarus americanus

KW - Matrix assisted laser desorption/ionization Fourier transform mass spectrometry

KW - Orcokinin

KW - Orcomyotropin

KW - Procambarus clarkii

KW - Sinus gland

KW - Stomatogastric ganglion

KW - Supraoesophageal ganglion

KW - cDNA

UR - http://www.scopus.com/inward/record.url?scp=58249122605&partnerID=8YFLogxK

UR - http://www.scopus.com/inward/citedby.url?scp=58249122605&partnerID=8YFLogxK

U2 - 10.1016/j.peptides.2008.10.009

DO - 10.1016/j.peptides.2008.10.009

M3 - Article

C2 - 19007832

AN - SCOPUS:58249122605

SN - 0196-9781

VL - 30

SP - 297

EP - 317

JO - Peptides

JF - Peptides

IS - 2

ER -

Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii

Abstract

Bibliographical note

Keywords

ASJC Scopus subject areas

Access to Document

Other files and links

Fingerprint

Cite this